PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004491981.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family LBD
Protein Properties Length: 166aa    MW: 18402.5 Da    PI: 5.2311
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004491981.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260142.41.4e-4410108199
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrrkC +dC++apyfp e+p+kfanvhk+FGasnv+kll+++++++reda++sl+yeAear++dPvyG+vg i+ lq+q+ +l++el+
  XP_004491981.1  10 PCAACKFLRRKCMPDCIFAPYFPPEEPQKFANVHKIFGASNVSKLLNEVQPNQREDAVNSLAYEAEARIKDPVYGCVGAISVLQRQVIRLQKELD 104
                     7*********************************************************************************************9 PP

          DUF260  96 llke 99 
                     ++++
  XP_004491981.1 105 ATNA 108
                     9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.8629110IPR004883Lateral organ boundaries, LOB
PfamPF031952.8E-4410107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MSSSSYTNSP CAACKFLRRK CMPDCIFAPY FPPEEPQKFA NVHKIFGASN VSKLLNEVQP  60
NQREDAVNSL AYEAEARIKD PVYGCVGAIS VLQRQVIRLQ KELDATNADL IRYTCTDITN  120
QDSRRIGEEG GSSLGQSPHE GFYYPSTPWN NDPLGDGYHT GGDNTM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012568850.11e-124PREDICTED: LOB domain-containing protein 25-like isoform X1
RefseqXP_012568851.11e-124PREDICTED: LOB domain-containing protein 25-like isoform X2
RefseqXP_004491980.11e-124PREDICTED: LOB domain-containing protein 25-like isoform X2
RefseqXP_004491981.11e-124PREDICTED: LOB domain-containing protein 25-like isoform X2
SwissprotQ8L8Q38e-69LBD25_ARATH; LOB domain-containing protein 25
TrEMBLV7B4I61e-105V7B4I6_PHAVU; Uncharacterized protein
TrEMBLV7B5G21e-105V7B5G2_PHAVU; Uncharacterized protein
STRINGGLYMA19G12650.32e-92(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.15e-70LOB domain-containing protein 25